DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni4b.3

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001018504.1 Gene:tnni4b.3 / 553694 ZFINID:ZDB-GENE-050522-63 Length:182 Species:Danio rerio


Alignment Length:185 Identity:62/185 - (33%)
Similarity:105/185 - (56%) Gaps:18/185 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE 150
            |.|::...|.|   :|..|:..|:..:.|||:..|::|:|:|..:|.:.:.|: |.|..||..|.
Zfish     1 MSESTPRSKPK---ITASRRLFLKTKILKKASTLLEEEKEQKRLDREQTLSEK-GPPLKLSGLSV 61

  Fly   151 GELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKF- 214
            .:||.:|:|.::::.:.:.:::|::.:|.|.:.||.|||.::.:|:||..:||||:|....:.. 
Zfish    62 QDLQNLCKELHQKIDVVDEERYDVQSKVTKNEKEIVDLNHKIFELKGKMKRPALKRVRVSADAML 126

  Fly   215 -AKLQKKAAE-FNFRNQLKVVKKKEFTLEEEEKEKKPDWSK------GKPGDAKV 261
             |.|..|..| .:|:..||.|||     |||:||:..||.|      |..|..|:
Zfish   127 GALLGAKHKESIDFKANLKTVKK-----EEEKKEEVTDWRKNVDAMSGMEGRKKL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 39/119 (33%)
tnni4b.3NP_001018504.1 Troponin 17..144 CDD:279349 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.