DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni3

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001011410.1 Gene:tnni3 / 496889 XenbaseID:XB-GENE-486987 Length:245 Species:Xenopus tropicalis


Alignment Length:272 Identity:75/272 - (27%)
Similarity:117/272 - (43%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EKKAAAPAAAPAAAAKPAAPAAAPAANGKAAPAANGKAAPAAAAAPAGPPKDPNDPKVKAEEAKK 69
            |::|......| ...|||.|||||                               |.::      
 Frog    19 EEEAEEEVVVP-EPPKPAPPAAAP-------------------------------PLIR------ 45

  Fly    70 AKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRI 134
                  .|..|..|....|....:|.|   ::..||.:|:.|:.:.|..|:::|:|.:|.|:.|.
 Frog    46 ------RRSSANYRSYATEPQVKRKPK---ISASRKLQLKSLMLQIAKAEMEREEEERAREKERY 101

  Fly   135 IEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKF 199
            :||.| .|..||..|..|||::|.|.:.|:.:.:.:::|:|.:|.|...||.|||.::.||||||
 Frog   102 LEEHC-EPLQLSGLSLSELQDLCRELHARIDVVDEERYDMEAKVNKNISEIEDLNLKIFDLRGKF 165

  Fly   200 VKPALKKVSKYENKFAKL---QKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSK------GK 255
            .||.|::|....:...:.   .|.....:.|..||.||:.:....:::..:..||.|      |.
 Frog   166 KKPNLRRVRLSADAMMRALLGTKHKVSMDLRANLKQVKQTKKDDADKDIREVGDWRKNVDALSGM 230

  Fly   256 PGDAKVKEEVEA 267
            .|..|..|...|
 Frog   231 EGRKKKFESTGA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 43/119 (36%)
tnni3NP_001011410.1 Troponin-I_N <44..57 CDD:371640 3/24 (13%)
Troponin 72..203 CDD:366404 46/131 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8047
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm48853
Panther 1 1.100 - - O PTHR13738
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.160

Return to query results.
Submit another query.