DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni2

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001011110.1 Gene:tnni2 / 496523 XenbaseID:XB-GENE-478629 Length:182 Species:Xenopus tropicalis


Alignment Length:187 Identity:62/187 - (33%)
Similarity:96/187 - (51%) Gaps:23/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERC---GSPRNLSDASEGELQEIC 157
            ||..::..||..|:.|:.:.|...|:||:...|||:...::|.|   ..|.|||     |||:.|
 Frog     6 KKSKISNTRKTHLKSLMLQVAKTALEKEEAEIAAEKEAYLQEHCPPLSLPSNLS-----ELQDFC 65

  Fly   158 EEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QK 219
            ::.:.::.:.:.:::|:|.:|.|...|:.|||.::.||||||.:||||:|....:...:.   .|
 Frog    66 KKMHAKIDVVDEERYDMEVKVGKSTKELEDLNQKIFDLRGKFKRPALKRVRMSADAMLRALLGSK 130

  Fly   220 KAAEFNFRNQLKVVKKKEFTLEEEEKEKK----PDWSKG---KPGDAKVKEEVEAEA 269
            .......|..||.|||     |:.:|||.    .||.|.   |.|....|:..|:||
 Frog   131 HKVNMELRANLKQVKK-----EDTDKEKDLRDVGDWRKNIEEKSGMEGRKKMFESEA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 40/122 (33%)
tnni2NP_001011110.1 Troponin 15..145 CDD:366404 43/134 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8047
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm48853
Panther 1 1.100 - - LDO PTHR13738
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.