DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni2a.4

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005163206.1 Gene:tnni2a.4 / 494164 ZFINID:ZDB-GENE-040625-119 Length:178 Species:Danio rerio


Alignment Length:178 Identity:61/178 - (34%)
Similarity:93/178 - (52%) Gaps:15/178 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 MTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERM 164
            ||..|:..|:.|:...|...|..|.::..|::...:.|.|  |......|..|||::|::.::::
Zfish     8 MTSSRRHHLKSLVLSIAFNLLDAEAKQHIADKESHMSENC--PALDLPGSVQELQDLCKKLHQQI 70

  Fly   165 YICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQ-----KKAAEF 224
            ...:.:::|:|.:|.|.|.||.||..:|.||:|||.|||||||....:  |.||     |.....
Zfish    71 DKVDEERYDMEAKVAKADKEIEDLKIKVIDLKGKFKKPALKKVRMSAD--AMLQALLGSKHKVSM 133

  Fly   225 NFRNQLKVVKKKEFTLEEEEKEKKPDWSKG---KPGDAKVKEEVEAEA 269
            :.|..||.|||:   ::||..|:..||.|.   |.|....|:..|:||
Zfish   134 DLRANLKQVKKE---VKEESVEQVGDWRKNIEDKAGMDGRKKMFESEA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 41/121 (34%)
tnni2a.4XP_005163206.1 Troponin 13..143 CDD:279349 43/133 (32%)
Carn_acyltransf <34..>122 CDD:279140 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586138
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.