DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni1b

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001008613.1 Gene:tnni1b / 494070 ZFINID:ZDB-GENE-041212-37 Length:182 Species:Danio rerio


Alignment Length:182 Identity:60/182 - (32%)
Similarity:94/182 - (51%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPR-NLSDASEGELQEI 156
            ::.||..::..||..|:.|:..||.|||::|...|..|:.:.:.|:  :|: ..|..|..||||:
Zfish     3 EQEKKSKISASRKLMLKSLMVAKAKEELEQELADKEDEKEKYLSEK--APQLQTSGMSFAELQEL 65

  Fly   157 CEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---Q 218
            |.|.:.::.:.:.:::|:|.:|.....||.|||.:|.||||||.:|.|::|....:...:.   .
Zfish    66 CRELHAKIDVVDEERYDIEAKVLHNTREIKDLNIKVLDLRGKFKRPTLRRVRVSADAILRSLLGS 130

  Fly   219 KKAAEFNFRNQLKVVKKKEFTLEEEEKEKK---PDWSK------GKPGDAKV 261
            |.....:.|..||.|||     |:.||||.   .||.|      |..|..|:
Zfish   131 KHKVSMDLRANLKSVKK-----EDTEKEKTVEVSDWRKNVEAMSGMEGRKKM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 39/120 (33%)
tnni1bNP_001008613.1 Troponin 15..146 CDD:279349 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586136
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.