DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni2a.1

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001007366.1 Gene:tnni2a.1 / 492493 ZFINID:ZDB-GENE-041114-60 Length:178 Species:Danio rerio


Alignment Length:178 Identity:61/178 - (34%)
Similarity:95/178 - (53%) Gaps:13/178 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 MTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERM 164
            |:..||..|:.|:...|...|::|...:..||.|.:.|.| .|.:|..:.:. |||:|.:.:.::
Zfish     6 MSSSRKHHLKSLMLSIAKGLLEQEVNDREVERERYMAETC-QPLSLPGSMQA-LQELCRDLHRKI 68

  Fly   165 YICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QKKAAEFNF 226
            .:.:.:::|||.:|.|...||.|||.:|.||:|||.||.|:||....::..:.   .|.....:.
Zfish    69 DVIDEERYDLEMKVNKCAKEIEDLNIKVIDLKGKFKKPTLRKVRMSADQMLQALLGSKHKVSLDL 133

  Fly   227 RNQLKVVKKKEFTLEEEEKEKKP--DWSKG---KPGDAKVKEEVEAEA 269
            |..||.|||:   ::||:||.:.  ||.|.   |.|....|:..||||
Zfish   134 RANLKQVKKE---VKEEDKELRDVGDWRKNVEDKAGMDGRKKMFEAEA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 39/119 (33%)
tnni2a.1NP_001007366.1 Troponin 11..139 CDD:279349 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586143
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.030

Return to query results.
Submit another query.