DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni4a

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001005998.3 Gene:tnni4a / 449825 ZFINID:ZDB-GENE-041010-75 Length:183 Species:Danio rerio


Alignment Length:184 Identity:61/184 - (33%)
Similarity:93/184 - (50%) Gaps:14/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE 150
            |.|..|.|.......:..|:..|:..|.|||...|.||:|.|..||...:.|| ..|.|||..|.
Zfish     1 MSEGPKKKNKSVSKYSATRRLLLKSKLLKKAEGLLVKEKELKDLERENTLRER-APPLNLSGLSV 64

  Fly   151 GELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKF- 214
            .||||:|::.:.::.:.:..::||..:|.:.|.||..|..::.:|:||..:|.|::|.|..... 
Zfish    65 QELQELCKDLHHKIDVVDEARYDLNIKVTRNDAEILSLTQKIYELKGKMKRPNLRRVKKSAEAML 129

  Fly   215 -AKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSK------GKPGDAKV 261
             |....:.::.:|:..||.|||     |||:||:..||.|      |..|..|:
Zfish   130 GALTDSRVSKADFKANLKTVKK-----EEEKKEEVTDWRKNVEAMSGMEGRKKL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 38/118 (32%)
tnni4aNP_001005998.3 Troponin 31..146 CDD:279349 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586137
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.