DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni2b.2

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001003423.1 Gene:tnni2b.2 / 445029 ZFINID:ZDB-GENE-040801-9 Length:176 Species:Danio rerio


Alignment Length:176 Identity:63/176 - (35%)
Similarity:96/176 - (54%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 MTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERM 164
            ||..|:..|:.|:...|.:.|..||::...:|...:||:| .|.:| ..|..||||:|:|.::::
Zfish     6 MTSSRRHHLKSLILGIAKDLLSAEQKQTEVDRVNYMEEKC-PPLSL-PGSVQELQELCKELHQKI 68

  Fly   165 YICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QKKAAEFNF 226
            .:.:.:::|:..:|.|.|.||.||..:|.||.|||.|||||||....:...:.   .|.....:.
Zfish    69 DVVDEERYDMSLKVAKSDKEIEDLKIKVQDLIGKFKKPALKKVRMSADSMLQALLGSKHKVSLDL 133

  Fly   227 RNQLKVVKKKEFTLEEEEKEKKPDWSKG---KPGDAKVKEEVEAEA 269
            |..||.|||:   ::||:||...||.|.   |.|....|:..|:||
Zfish   134 RANLKQVKKE---VKEEDKEAVGDWRKNIEDKAGMGGRKKMFESEA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 42/119 (35%)
tnni2b.2NP_001003423.1 Troponin 11..139 CDD:279349 43/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586135
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.990

Return to query results.
Submit another query.