DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni4b.2

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001002101.1 Gene:tnni4b.2 / 415191 ZFINID:ZDB-GENE-040625-81 Length:180 Species:Danio rerio


Alignment Length:185 Identity:63/185 - (34%)
Similarity:96/185 - (51%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 MEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASE 150
            |.|:.:.|..    ::..|:..|:..|.|||...|..|:|.|..||...:.||. .|..||..|.
Zfish     1 MSESQRPKSK----ISASRRLFLKTKLLKKACAMLVTEKEDKQTERENTLAERV-PPLQLSGLSV 60

  Fly   151 GELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALK--KVSKYENK 213
            .:||.:|.:.::::.:.:.:::|:..:|.|.:.||.|||.::.:||||..:||||  |:|.....
Zfish    61 QDLQALCRDLHQKIDVVDEERYDIAAKVSKNEKEITDLNIKITELRGKMKRPALKRVKISADAML 125

  Fly   214 FAKLQKKAAE-FNFRNQLKVVKKKEFTLEEEEKEKKPDWSK------GKPGDAKV 261
            .|.|..|..| .:|:..||.|||     |||:||:..||.|      |..|..|:
Zfish   126 GALLGSKVKESVDFKANLKTVKK-----EEEKKEEVTDWRKNVEAMSGMEGRKKL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 41/119 (34%)
tnni4b.2NP_001002101.1 Troponin 27..143 CDD:279349 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586133
Domainoid 1 1.000 76 1.000 Domainoid score I8860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5072
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm24311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.