DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tnni1.2

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_988959.1 Gene:tnni1.2 / 394556 XenbaseID:XB-GENE-485710 Length:183 Species:Xenopus tropicalis


Alignment Length:165 Identity:56/165 - (33%)
Similarity:90/165 - (54%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ERKKKL----RLLLR----KKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEE 159
            |||.|:    ||||:    :||.|||:||:.....|:.||::|:..| ..::..|..:|||:|.:
 Frog     6 ERKSKIPASRRLLLKTLMLQKATEELEKEKREADEEKTRILDEKVPS-LQIAGLSLQQLQELCTK 69

  Fly   160 YYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QKKA 221
            .::::...:.:::|:|.:|:|.|.||..|..::.||:|||.:|.||:|....:...|.   ....
 Frog    70 LHKQIDSVDEERYDIEVKVKKHDIEIEGLTQKIFDLKGKFKRPNLKRVRISADAMLKALLGNTHK 134

  Fly   222 AEFNFRNQLKVVKKKEFTLEEEEKEKK---PDWSK 253
            ...:.|..||.|:|      |:||||.   .||.|
 Frog   135 VSVDLRANLKSVRK------EDEKEKTVEVTDWRK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 37/119 (31%)
tnni1.2NP_988959.1 Troponin 16..147 CDD:395788 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8047
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4906
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm48853
Panther 1 1.100 - - O PTHR13738
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.