DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and Tnni3

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_017177599.1 Gene:Tnni3 / 21954 MGIID:98783 Length:219 Species:Mus musculus


Alignment Length:205 Identity:63/205 - (30%)
Similarity:105/205 - (51%) Gaps:19/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AEEAKKAKQAEIERKRAE-------VRKRMEE-----ASKAKKAKKGFMTPERKKKLRLLLRKKA 116
            |:|:..|...|:.....|       ||:|...     |::....||..::..||.:|:.|:.:.|
Mouse     2 ADESSDAVSCELRSGAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIA 66

  Fly   117 AEELKKEQERKAAERRRIIEERCGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKK 181
            .:|:::|.|.:..|:.|::..|| .|..|......|||::|.:.:.|:...:.:::|:|.:|.|.
Mouse    67 KQEMEREAEERRGEKGRVLRTRC-QPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKN 130

  Fly   182 DWEINDLNAQVNDLRGKFVKPALKKV--SKYENKFAKLQKKAAE-FNFRNQLKVVKKKEFTLEEE 243
            ..||.||..::.||||||.:|.|::|  |......|.|..:|.| .:.|..||.|||::.   |:
Mouse   131 ITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDI---EK 192

  Fly   244 EKEKKPDWSK 253
            |..:..||.|
Mouse   193 ENREVGDWRK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 40/119 (34%)
Tnni3XP_017177599.1 Troponin-I_N 1..40 CDD:371640 8/37 (22%)
Troponin 55..186 CDD:366404 43/131 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841748
Domainoid 1 1.000 76 1.000 Domainoid score I8924
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm43681
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.