DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and Tnni1

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001106173.1 Gene:Tnni1 / 21952 MGIID:105073 Length:187 Species:Mus musculus


Alignment Length:180 Identity:56/180 - (31%)
Similarity:90/180 - (50%) Gaps:22/180 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRIIEERCGS--PRNLSDASEGELQEICE 158
            :|..:|..||..|:.|:..||.|..::|.|.:.||:.|.:.||..:  .|.||.::   ||::|.
Mouse     6 RKSKITASRKLMLKSLMLAKAKECWEQEHEEREAEKVRYLSERIPTLQTRGLSLSA---LQDLCR 67

  Fly   159 EYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKL---QKK 220
            |.:.::.:.:.:::|:|.:......||.||..:|.||||||.:|.|::|....:...:.   .|.
Mouse    68 ELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVLDLRGKFKRPPLRRVRVSADAMLRALLGSKH 132

  Fly   221 AAEFNFRNQLKVVKKKEFTLEEEEKEKK---PDWSK------GKPGDAKV 261
            ....:.|..||.|||     |:.|||:.   .||.|      |..|..|:
Mouse   133 KVSMDLRANLKSVKK-----EDTEKERPVEVGDWRKNVEAMSGMEGRKKM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 36/121 (30%)
Tnni1NP_001106173.1 Involved in binding TNC 2..48 14/41 (34%)
Troponin 15..146 CDD:395788 40/133 (30%)
Involved in binding TNC and actin 97..118 11/20 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841750
Domainoid 1 1.000 76 1.000 Domainoid score I8924
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5129
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm43681
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.