DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tni-1

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_509906.1 Gene:tni-1 / 181329 WormBaseID:WBGene00006584 Length:250 Species:Caenorhabditis elegans


Alignment Length:210 Identity:100/210 - (47%)
Similarity:138/210 - (65%) Gaps:11/210 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAA 129
            |:|:: |..|.|.|:||||||:|||.: ||.||||:|||||||||.||..||||:||.:|.||..
 Worm    20 EDAQR-KAQEREAKKAEVRKRLEEAGQ-KKQKKGFLTPERKKKLRKLLMNKAAEDLKTQQLRKEQ 82

  Fly   130 ERRRIIEERCGSPRNLSDASE-GELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVN 193
            ||.:::.||..:..|:....: .:|:.|..:.:.|:...|.:|:|:.:...:.:..||.||.:||
 Worm    83 ERVKVLAERTVALPNVDSIDDHAKLEAIYNDLFSRLCNLEEEKYDINHITTETETTINQLNIEVN 147

  Fly   194 DLRGKFVKPALKKVSKYENKFAKL---QKKAAEFNFRNQLKVVKKKE-FT-LEEEEKEKKPDWSK 253
            |||||||||:|||||||:|||.|:   :|:....|.||.||.|||:. || :..::|..||:|||
 Worm   148 DLRGKFVKPSLKKVSKYDNKFKKMAEAKKEDGSKNLRNNLKTVKKESVFTQIANKKKSDKPEWSK 212

  Fly   254 GKPGDAKVKEEVEAE 268
            .|   .:.|||...|
 Worm   213 KK---EEKKEESAPE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 51/120 (43%)
tni-1NP_509906.1 Troponin 58..191 CDD:279349 59/132 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162111
Domainoid 1 1.000 122 1.000 Domainoid score I3484
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H50690
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29067
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm14071
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.720

Return to query results.
Submit another query.