DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wupA and tni-3

DIOPT Version :9

Sequence 1:NP_728142.1 Gene:wupA / 32794 FlyBaseID:FBgn0283471 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_507250.1 Gene:tni-3 / 180127 WormBaseID:WBGene00006585 Length:260 Species:Caenorhabditis elegans


Alignment Length:213 Identity:104/213 - (48%)
Similarity:140/213 - (65%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VKAEEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQER 126
            |:.:.|:||::.|:  |:||||||||||:|....||||:|||||||||.||..||||:||::|..
 Worm    17 VEDDAARKAQEREL--KKAEVRKRMEEAAKKGSKKKGFLTPERKKKLRKLLMMKAAEDLKQQQML 79

  Fly   127 KAAERRRIIEER-CGSPRNLSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNA 190
            |..||::.:::| ...|...|...:|:|.:|.|:.:.|:...|.:|:|:.:.|.:.:.|||.|..
 Worm    80 KEQERQKTLQQRTIPLPDVDSINDQGQLLKIYEDMFARVCALEEEKFDINFGVSQTEAEINQLTI 144

  Fly   191 QVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEK------KP 249
            ||||||||||||.|||||||:|||....:...:.||||.|||| |||..|:|...:|      ||
 Worm   145 QVNDLRGKFVKPTLKKVSKYDNKFKSSGEVKEKSNFRNNLKVV-KKETDLDEIMAKKKGTADGKP 208

  Fly   250 DWSKGKPGDAKVKEEVEA 267
            :|||      |.|:|.||
 Worm   209 EWSK------KEKKEEEA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wupANP_728142.1 Troponin 116..233 CDD:395788 53/117 (45%)
tni-3NP_507250.1 Troponin 58..188 CDD:279349 63/130 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162114
Domainoid 1 1.000 122 1.000 Domainoid score I3484
eggNOG 1 0.900 - - E1_KOG3977
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H50690
Inparanoid 1 1.050 195 1.000 Inparanoid score I2526
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29067
OrthoDB 1 1.010 - - D1566919at2759
OrthoFinder 1 1.000 - - FOG0000525
OrthoInspector 1 1.000 - - otm14071
orthoMCL 1 0.900 - - OOG6_105874
Panther 1 1.100 - - O PTHR13738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2854
SonicParanoid 1 1.000 - - X413
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.