DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG18765

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:412 Identity:81/412 - (19%)
Similarity:149/412 - (36%) Gaps:62/412 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTR------------GGENYCSNIYRAQIKYRNA 61
            ||.:|.|....:|...:::.:|:.:..|::...:            .....|     ..|:...|
  Fly     4 PLLVTQQSQDASLPTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPALC-----VHIQVLVA 63

  Fly    62 ESCAMETSLIVKSMPDEKQAI-LARLHIYNKETLFYMHIKPKLEALMWRA--VDSFSAWTLAPK- 122
            ::...:.|.::||.......: |.|...::.|...:..:.|.||.|...:  :..|....:..| 
  Fly    64 DNKKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKL 128

  Fly   123 ---HYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIV 184
               |.|.          :.:...||.:.....||.......|::|||.|||.|.....:.|..|.
  Fly   129 KSSHIYG----------DYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIR 183

  Fly   185 DRYPFGLLHMDAINSEP-------FKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVL 242
            :   ...|..::.:.|.       ::|.|...|..     .|...:........:|.:..||   
  Fly   184 E---LPKLRENSKSDEETAELKSLYQLRFHESLRS-----NDARQYEDKVKSFQKYVKSGTE--- 237

  Fly   243 KAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDI-NYFLNTSLELE 306
              :...:.:.||:.:|..|.||:..:.||...|:......|....||...:|: :..|....|..
  Fly   238 --ILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAEKS 300

  Fly   307 VLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDS 371
               .|....|..|:..|::.|..|.:..:.||..|:..::.|...:.|..|....|::..   |.
  Fly   301 ---SRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLS---DF 359

  Fly   372 EDNSLKN-FHDETFARQKVQLM 392
            .:|.::. |.:..|..|..:|:
  Fly   360 GNNDIEELFRNPVFGEQIRELL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 60/301 (20%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 60/292 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.