DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CHKov2

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:425 Identity:111/425 - (26%)
Similarity:188/425 - (44%) Gaps:70/425 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDALEEPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCA 65
            |:|  :..|.::|.:.|...||...:... .:|....|:....||||.:.:.|.||:.:..::..
  Fly     1 MTD--QPTPQWVTKELFSSLLEQSNRNFK-AIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSI 62

  Fly    66 METSLIVKSMP----DEKQAILARLH-IYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYY 125
            .:.|.|:| :|    |||.    ..| :::.|...|.|:.|:||.|.  |.::..:....|.|..
  Fly    63 EDVSYILK-IPLVPEDEKN----DFHEMFDAELDMYDHLIPELEDLY--AKNTSISPKFKPVHLK 120

  Fly   126 STTQPEQT--IILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAER---------- 178
            ...:|.::  |:||||...||:...|..||:......|:.|||::||.:   |:|          
  Fly   121 FPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAAS---AKRVVELGEYEKD 182

  Fly   179 --------EPETIVDRY------PFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTK 229
                    |.:.::|.:      || |..|...|.||.:|:          |:.|      .|::
  Fly   183 IRESYFTTEHQKLLDEFNINFCMPF-LECMQQYNLEPGQLV----------LISD------YTSQ 230

  Fly   230 LYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFD 294
            |...:..|.:.     .||  ..:||||||.|.||..|||.....|:.|..:||||..||:...|
  Fly   231 LTDLNIEFGKN-----DPL--ELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQD 288

  Fly   295 INYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFG 359
            :...|.||.:..:..|:....::.|::.||:.|..|.:::..|:.......:.:...:.|..|..
  Fly   289 LLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQR 353

  Fly   360 FFPLMSM-IGVDSEDNSLKNFHDETFA-RQKVQLM 392
            ..|::.: ..|||...::....:|..| ::|:.|:
  Fly   354 MLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 90/317 (28%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 91/319 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.