DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG31097

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:379 Identity:89/379 - (23%)
Similarity:150/379 - (39%) Gaps:84/379 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GENYCSNIYRAQIKYRNAESCAMETSLIVKSM--PDEKQAILARLHIYNKETLFYMHIKPKLEAL 106
            |.|:.|.:.|..:.....:......|.:||:|  .|:....:..:..::||...|....|:.|  
  Fly    47 GGNFASVMLRVYLDIVMKDGSQKRKSYVVKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFE-- 109

  Fly   107 MWRAVDSFSAWTLAPKHYYSTTQPEQTI---------------ILEDLCAAGYQLKCRQLGLDFD 156
                           |.|.....|.|.:               |.|||....:....|..|::.:
  Fly   110 ---------------KIYRVAGHPVQLMPKCLEIGEIDGNIYFIFEDLSTRNFVAADRTKGVNME 159

  Fly   157 HAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAIN--SEPFKLLFGTQLLKL------ 213
            |..|.:.||||.||.:::..||          :|..|.|..|  :...|:....:..::      
  Fly   160 HMRLSLRKLAELHAASVIYKER----------YGPYHADFDNGFARKDKIEHSVRRFEVKAPEYK 214

  Fly   214 AAL----VGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYT 274
            ||:    :.:|      ..|.:...|.:.:..|:::.....:.|||.|||...:||.|||:....
  Fly   215 AAMKTWGIDEC------YLKNFPTTEQYGKLCLESLNVDPQDFNVLTHGDFSPSNILFKYNENGA 273

  Fly   275 VQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRR-------QELVDIYYRSLVDCLKHLPW 332
            ..:..|:|||:|.:.|...|:       |.|.:|..|:       ..:|.||:..|:|.|:.|.:
  Fly   274 PSEALILDFQICKWASPTQDL-------LMLIILSARKDSSYKEFDNIVRIYWEYLIDFLRVLKY 331

  Fly   333 SKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVD----SEDNSLKNFHDE 382
            .|.||...::...|.|:.  ..|.|  ||.:|:.:..|    .::|:|..|:.|
  Fly   332 KKPLPQLRELQSAIYKKN--NTFSA--FFAVMNHLPGDLLPVCKENNLHTFNLE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 73/321 (23%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 74/323 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459242
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.