DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG11893

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:426 Identity:104/426 - (24%)
Similarity:204/426 - (47%) Gaps:42/426 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAES--CAMETS 69
            |.|.:|..||....|....:..:|:|..:::|..:..|::|.|.::|...:|..::.  |   ..
  Fly    16 EAPAWLNAQFITDVLRTYEKCPELEVTDLKITPASAQGDHYASVMFRTTAEYTTSKGKFC---KP 77

  Fly    70 LIVKSMPDE---KQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPE 131
            ||:|:||::   |:.:|:..|:::.|...|....|:.|.::..|.|....:  .|..|:| .:|.
  Fly    78 LIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLF--VPCIYHS-LEPR 139

  Fly   132 QTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDA 196
            |.:|.|||...|| ...|...::.:....|.:|||::||::|.:...:|:.:.| :.:||:.|.:
  Fly   140 QVLIFEDLVPQGY-FVIRDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKD-FKYGLMEMPS 202

  Fly   197 INSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYH-----EHFTERVLKAVYPLRGN----- 251
            |.|:|.........||:...:.:       .|| |:.|     |::.:|:...:...|.|     
  Fly   203 IMSDPMVTTGMDNFLKMMDQIPE-------LTK-YKPHFEKIKENYIQRMGDVMQEYRKNVQSDG 259

  Fly   252 HNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELV 316
            :.|:.|||....|:.|..:     ::|..:|||:|....:..|::|.:...:|.|...|..::|:
  Fly   260 YYVMCHGDFHGRNMMFNKN-----EEVMFVDFQICNLCPITIDLSYSVYMLMEPEQRWDLGKDLI 319

  Fly   317 DIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHD 381
            :.|:..|.|.||.:.:..::|:.:.:..:|.:.:.|.||:...|.|:  ::.|.:....:.....
  Fly   320 NFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPM--IVAVKANTFKIHELIQ 382

  Fly   382 ETFARQKVQLMFEGNTRTLESLKCTLKRLDELKLFD 417
            :...|||..|.    ...::.:|..|.:.:|:..|:
  Fly   383 DPEIRQKSYLY----DPYVQDVKKLLGKYEEMGYFN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 79/301 (26%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 79/303 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.