DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG31104

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:402 Identity:102/402 - (25%)
Similarity:197/402 - (49%) Gaps:42/402 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLI 71
            :.|.:|..||....|....|..||:|..:|::..|..|::|.|.::|.:::|...:....: .||
  Fly    14 QAPAWLNAQFIGDILREYEQLPDLKVTDLQVSPATAQGDHYASVMFRTKVEYTTPKGKFFK-PLI 77

  Fly    72 VKSMPDE---KQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQT 133
            :|:||::   |:.:|:..|::..|...|.|..|:.|.::..|.|:...:  .|..|:| .:|.|.
  Fly    78 IKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLF--VPCIYHS-LKPRQV 139

  Fly   134 IILEDLCAAGYQL------KCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLL 192
            :|.|||...||.:      ....|.|.||       |||::||::|.:...:| ..:..:.:||.
  Fly   140 MIFEDLVPQGYTVIRDSPPSLGDLKLAFD-------KLAKWHAVSMKVINEQP-YFLKEFQYGLF 196

  Fly   193 HMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYH-----EHFTERV---LKAVYPLR 249
            .|..|:::||.....|..:::...:.:        .:.|::|     :::.:|:   :...:..|
  Fly   197 EMPTIDTDPFITTGMTNFIEMLDKMPE--------LRKYKHHFEKIKDNYMQRLEVEMHEYHKYR 253

  Fly   250 GN--HNVLNHGDLWVNNIFFKYDAEY-TVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDR 311
            .|  :.||.|||..:.|:.|:::.|. ....|.::||||.....:..|:.|.:...:|.|...:.
  Fly   254 RNDRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEM 318

  Fly   312 RQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL 376
            .:.|::.|:..||..|:.:.:..::|:..::.::|:..:.|.||:...|.|:  |:||.|.|..:
  Fly   319 GENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPI--MVGVKSNDLKM 381

  Fly   377 KNFHDETFARQK 388
            .....::.||.|
  Fly   382 HEALQDSQARLK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 76/306 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 76/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459304
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.