DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG6908

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:419 Identity:104/419 - (24%)
Similarity:184/419 - (43%) Gaps:46/419 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALEEPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMET 68
            |:|..|.:|..|.|...||.....|. ::...:|......||||.:.:.||..:....:......
  Fly    43 AIEPIPAWLDQQKFEPILERDFPDLK-KIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSI 106

  Fly    69 SLIVKSMPDE-KQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQ-PE 131
            |.:.|.:|:. .:..:|...::.||...|....|:.|. |::  |:....:..|::|.|..: .:
  Fly   107 SYMAKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQ-MYK--DAGKKISFGPRYYESQIELDD 168

  Fly   132 QTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAERE---PE-------TIVDR 186
            :.|:||||...|::...||.|||..|....:.|||::||.:.|..|.:   ||       ::|| 
  Fly   169 ELIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVD- 232

  Fly   187 YPFGLLHMDAINSEPFKLLFGT-QLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRG 250
                  .:..:.....|..... .|...:.|..|.:.:|.....::   :.|..::       .|
  Fly   233 ------SLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMF---QSFAPKI-------EG 281

  Fly   251 NHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQEL 315
            ...||||||.|.|||.::||....:.:|..:|.|:..:.|...|:.|.:.:|.||::...:...|
  Fly   282 EFRVLNHGDAWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYL 346

  Fly   316 VDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMS----MIGVD-SEDNS 375
            :..|:..|::.||.|.:.|.|||...:...|   ..||.::    .|::|    ::.:| .:|.:
  Fly   347 IKFYHEKLIESLKLLKYPKPLPSLRSLHQSI---FIYGDWI----LPIVSILLPLVLIDGGDDAN 404

  Fly   376 LKNFHDETFARQKVQLMFEGNTRTLESLK 404
            :.:..|...|..|::.....|.|.::..|
  Fly   405 MDSLMDGEGAGDKIRNNMFKNHRVIKHQK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 76/299 (25%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 77/301 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.