DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG6830

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:307 Identity:74/307 - (24%)
Similarity:155/307 - (50%) Gaps:15/307 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TRGGENYCSNIYRAQIKYRNAESCAMETSLIVKSMPDEKQAILARLHIYNKETLFYMHIKPKLEA 105
            |:.|:|:.|.:.:.:|:.:..::.....|.|:|...|......:..:::.||...|....|..|.
  Fly   514 TKPGDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDAINFSDFNLFPKEIEVYSTYVPAFER 578

  Fly   106 LMWRAVDSFSAWTLAPKHY-YSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYH 169
            ..   .|.....|.:||.: .|....::.::||:|..:|:::..|.:|:|.:|:...:.|||::|
  Fly   579 FY---KDVGLPVTFSPKSFRLSKDVSKEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWH 640

  Fly   170 ALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKLLF-GTQLLKLAALVGDCEGFGGITTKLYRY 233
            |.::...|...       |:...:.:.|.:|....:| |..:....:.:.:...|.|:...|::.
  Fly   641 AASLKYKELNG-------PYSPKYNNGIFTEQTAPIFKGMFVNTKKSFIEEVSKFDGVDEYLHKM 698

  Fly   234 HE---HFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDI 295
            .|   .:.:|:|:.........|||||||.|:|||.|:|:::..|::..::|.|:..||:...|:
  Fly   699 PEILDTYVDRILEDAKINEQAFNVLNHGDAWINNIMFQYESDGRVKETLLLDHQVTKYGNPAQDL 763

  Fly   296 NYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDI 342
            .||:.:|.:|::..|:...|:..|::::.:..|.|.::..:||.:::
  Fly   764 YYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYNGFIPSLKEL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 70/291 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 71/293 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459254
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.