DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG16898

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:428 Identity:111/428 - (25%)
Similarity:175/428 - (40%) Gaps:56/428 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVK 73
            |.:||.::.:..|....:...|:|:.|.....|..|:||.|.:.|..::.:..:......:.|:|
  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK 67

  Fly    74 SMPDE---KQAILARLHIYNKETLFYMHIKPKLEALMWRA--VDSFSAWTLAPKHYYSTTQPEQT 133
            ....|   :..:.....:||:|...|..|.||:..|:...  ...|:|.|:.....|      :|
  Fly    68 ESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREY------RT 126

  Fly   134 IILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIV----------DRYP 188
            ||||||....|....|...||..|..|.:..||::||.::|:.:|.||.:.          |...
  Fly   127 IILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKG 191

  Fly   189 F-----GLL--HMDAINSEP-FKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAV 245
            :     |:|  .:..||.:| .|..:|.:|.|:...:.|   :|.      |..|...:.:|   
  Fly   192 YTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMD---YGA------RTFEVGEQELL--- 244

  Fly   246 YPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRD 310
                    .|:|||.|..|..::||.....|....||||...:.|...|::.|...||..|| :|
  Fly   245 --------TLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEV-QD 300

  Fly   311 RRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIG--VDSED 373
            ....||:.||..|...:..|.:....||.:....:...|. :...:|..|.|::...|  |.|:.
  Fly   301 MESVLVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRR-FMCLLAHLFKPVIIYDGTEVSSDF 364

  Fly   374 NSLKNFHDETFARQKVQLMFEGNTRTLESLKCTLKRLD 411
            :|:....:|....||.   ...|.|.|:|....|..||
  Fly   365 SSVYKDTEEGIRFQKA---IYANERVLKSATKLLAMLD 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 82/309 (27%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 83/311 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459186
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
98.860

Return to query results.
Submit another query.