DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG9259

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:429 Identity:101/429 - (23%)
Similarity:183/429 - (42%) Gaps:56/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDALEEPPLY---LTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYC-SNIY-RAQIKYRN 60
            |:.|||..|..   |..::|.:.:.:.....|  ::...|...:.....|. |::| ...:|..|
  Fly     1 MATALELSPTEIRGLCQRYFHQDVSNSDTGFD--IVNYTLKPTSDAPAGYLGSHLYLHVTLKLHN 63

  Fly    61 AESCAMETSLIVKSMP---DEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPK 122
            :|. ..:.:...||.|   :.:...|....::.||...|.::.|.|..         :...:|||
  Fly    64 SEE-VRQLTFFSKSAPVGNESRMEYLEDFGVFEKEIAVYQNVLPDLHK---------ACAEVAPK 118

  Fly   123 HYYSTTQPEQTIILEDLCAAGYQLKCRQLG-LDFDHAALVMAKLAEYHALTMV--------MAER 178
            .||:   .:..:|.|:|...||::...:.| |.::.....:..||..||.:::        :|:.
  Fly   119 CYYA---DKNLLIFENLADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQS 180

  Fly   179 EPETIVDR-YPFGLL--HMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTER 240
            :|:::|:. ||..:.  ||..:|.:...|:. .:.:||         .....:||....|:|||:
  Fly   181 QPKSVVENAYPSDVSPEHMRMVNFQNACLVL-KEFIKL---------IPKYQSKLDYVLENFTEK 235

  Fly   241 ---VLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQ-QVKIIDFQLCFYGSLGFDINYFLNT 301
               :.:||.......|.:.|||||.|||.|:|.....|. |.:::||||..|.....|:...|..
  Fly   236 MSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTI 300

  Fly   302 SLELEVLRDRRQELVDIYYRSLVDCLKH--LPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLM 364
            ....|.......||:..|||.:.:.||.  |..::.:|. :...:.::|..:.|...:..|..|:
  Fly   301 PTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHLV 364

  Fly   365 SMIG--VDSEDNSLKNFHDETFARQKVQLMFEG-NTRTL 400
            .:..  .....:|:..|:| .|..:::::..|. ||..|
  Fly   365 ILPPHCTQKLTSSVDGFND-FFTNKRIEICLEAFNTDEL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 78/309 (25%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 74/293 (25%)
APH <252..325 CDD:279908 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.