DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and F59B1.10

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:398 Identity:78/398 - (19%)
Similarity:145/398 - (36%) Gaps:109/398 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KYRNAESCAMETSLIVKSMPDEKQAIL----ARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAW 117
            |.:||       |||.|.:.::..|..    .::|  |:|..||            .....|::.
 Worm    94 KQQNA-------SLITKEVEEQMYAYFESSCKKMH--NQEMNFY------------EVAGKFNSK 137

  Fly   118 T-LAPKHYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALV---------------MAKLA 166
            | |.||.|:.|...|:.      ...|:      :|:::...::|               :..:|
 Worm   138 TLLIPKVYFYTKLDEKN------SNKGF------IGMEYVEGSIVRHSYDTCTIEEIQPILRAIA 190

  Fly   167 EYHALTMVMAEREPETI------VDRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEG--- 222
            :..||::    :.|..|      :|.        .||..|..|::.....:|  .:...|..   
 Worm   191 KLQALSL----QNPAEISKDLQKIDN--------GAIFQETLKMMLSESGIK--GIFEQCRNLER 241

  Fly   223 --FGGITTKLYRYHEHFTERV-------LKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQV 278
              ||   .|:.|..|...|.:       |..|..::  .|||.|||||..| |...:........
 Worm   242 SRFG---EKVDRIEEKRNEILDFEKAFNLNKVVGIK--QNVLCHGDLWAAN-FLWTENNGVFCAT 300

  Fly   279 KIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIM 343
            :|:|:|:...|:...|:...|.:::.....:...|::::.:|...::         ||.|.|...
 Worm   301 RIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFYSYFLN---------ELGSGEAPY 356

  Fly   344 DEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLMFEGNTRTLESLKCTLK 408
            ...:.:.::..:...|...|:.:.| .:.|..|:....|  ..:|.:.:      .:|.:.|.|.
 Worm   357 TLEQLKLSFKLYFPVGALALLPLFG-PAVDAKLEGMDSE--KAEKCRHV------VIEKVACLLD 412

  Fly   409 RLDELKLF 416
            .|::...|
 Worm   413 DLEKYHKF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 62/310 (20%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 78/398 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.