DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and E02C12.19

DIOPT Version :10

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001343835.1 Gene:E02C12.19 / 34700618 WormBaseID:WBGene00271797 Length:185 Species:Caenorhabditis elegans


Alignment Length:112 Identity:27/112 - (24%)
Similarity:52/112 - (46%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 LLHMDAINSEP-------FKLLFGTQ--LLKLAALV---GDCEGFG-------GITTKLYRYHEH 236
            |:.:|.:|.|.       |.:...||  ||:|:.::   |: .|||       |.||:.:...|.
 Worm    55 LIEVDWVNKEEDRQLPSRFAVKISTQVPLLELSKIIKFSGE-NGFGEDKLKRLGKTTREFHNREV 118

  Fly   237 FTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDF 283
            .:.::|     :|.||..:.:..::.   |.|:|.:..::...|:|:
 Worm   119 DSYKLL-----MRYNHPNIPYTKVYG---FKKFDDDNDLKGFLIVDY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKL 43..330 CDD:397213 27/112 (24%)
E02C12.19NP_001343835.1 Protein Kinases, catalytic domain 3..>164 CDD:473864 27/112 (24%)

Return to query results.
Submit another query.