DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG33509

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:338 Identity:84/338 - (24%)
Similarity:140/338 - (41%) Gaps:48/338 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLQVIGVQLTNLTRGGENYCSNIYRAQIKY-RNAESCAMETSLIVKSMPDEKQAILARLHIYNKE 92
            ||..||            |..:.|...::| ...|....|..|.||:|| ::.|.|::..|:.||
  Fly    31 DLSAIG------------YLGDYYALTLRYCHEEEEIIREIELFVKAMP-QQSAELSKESIFQKE 82

  Fly    93 TLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILEDLCAAGYQLKCRQLGLDFDH 157
            :..|..:..||:||      |...|  :|...||.   :..::||::...|: .......|:...
  Fly    83 SWLYDTLIKKLQAL------SNVKW--SPNCVYSR---KDLMVLENIKLKGF-TSAGSAELNEVF 135

  Fly   158 AALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEG 222
            ...::..:|.:|:.::|...:....|...|...||.: .::||  ...|.|.|..:.|:|.....
  Fly   136 VKPLIKSIAAFHSASLVYEHQTKTNIGHTYGDNLLEI-TVDSE--IAWFTTGLSAVLAVVRSLAK 197

  Fly   223 FGG------ITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKII 281
            :.|      |..||.    ...|.:.:...|.:...|||.|.|:|..||||..:   ......:|
  Fly   198 YQGNREQSFIGDKLM----GIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPE---NSGPALLI 255

  Fly   282 DFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEI 346
            |||.|.|.....|:|:.|..:|.....:...::.:|:|:..|:..|..|...:.:.|..:::   
  Fly   256 DFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLEELVISKSELL--- 317

  Fly   347 RKREAYGFFVAFG 359
               |:|..|..||
  Fly   318 ---ESYEEFRLFG 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 73/293 (25%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459281
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.