DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG33510

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:356 Identity:71/356 - (19%)
Similarity:136/356 - (38%) Gaps:92/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 MPDEKQAILARLHI-----YNKETLFYMH----IKPKLEAL-MWRAVDSFSAWTLAPKHYYSTTQ 129
            :.|:|....:||.:     .|....|||.    |:.:::.. :...:..||....:.|.|::.  
  Fly    68 LEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYDLLNELKKFSKHVWSAKCYFTR-- 130

  Fly   130 PEQTIILEDLCAAGYQ--------LKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETI--- 183
             :...:::::...||.        |...|:|       .::..||..||.::...:::.:||   
  Fly   131 -KDLFVMQNVEDMGYVALPPGTRFLNENQMG-------PILKSLATLHASSIAYEKQQGKTIGVE 187

  Fly   184 -------------VDRYPFGL--------LHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGIT 227
                         |:.|..||        :|.|.:::...:.....:|.:       |       
  Fly   188 FRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPR-------C------- 238

  Fly   228 TKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLG 292
                      .::|...|.|...:.||..|.|.|..|:|:..:..:..:.: ::|||||.|....
  Fly   239 ----------LDKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHEERSI-LVDFQLCRYSPPA 292

  Fly   293 FDINYFLNTSLELEVLRDRRQ--ELVDIYYRSLVDCLKHL---PWSKELPSYEDIMDEIRKREAY 352
            .|  :.|.|.|.||....::.  .|::.||.:|.:..:.:   |:.::|...|       ..::.
  Fly   293 MD--FHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQLSKQE-------FEQSL 348

  Fly   353 GFFVAFG-FFPLMSMIGVDSEDNSLKNFHDE 382
            ..|..|| .:..::...:...||.|||..||
  Fly   349 NDFSLFGATYNCIAATVLRLPDNYLKNLKDE 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 58/298 (19%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 45/228 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459282
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.