DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG33511

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:353 Identity:91/353 - (25%)
Similarity:149/353 - (42%) Gaps:53/353 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HGLQQLDLQVI---GVQLTN--LTRGGEN---YCSNIYR----AQIKYRNAESCAMETSLIVKSM 75
            |.:.|..|.|:   .|.|.|  :..|.::   |....|:    |::|   .:......:..:||:
  Fly    10 HLIAQRTLSVVKKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVK---GDKKKYFLNYFIKSL 71

  Fly    76 P---DEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILE 137
            |   :.::....|..::.||:..|..|.||::        .::...|.||.|||.   ...::||
  Fly    72 PRKNEPQREECERKGVFQKESALYSQILPKIQ--------KYATKKLYPKCYYSR---NDILVLE 125

  Fly   138 DLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGL--LHMDAINSE 200
            ||......|:..:. ...||..:|:..|:|.||.::...|:|...|.:.|...|  ||:|:.|| 
  Fly   126 DLTQDYRHLRANEY-YTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNNS- 188

  Fly   201 PFKLLFGTQLLKLAALVG--------DCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNH 257
                .:.|.|..:..|..        ..:.|  |..|||    :...:..:.|.|.:...|||.|
  Fly   189 ----WYITGLKAIVFLAARNPHFQTMKAQNF--IQDKLY----NLLTKAEELVAPSKTIRNVLCH 243

  Fly   258 GDLWVNNIFFKYDAEYTV--QQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYY 320
            .|.|.:||.:.::.|.:|  ....|:||||..|.|...|:.:.|......||.|....|.::.||
  Fly   244 RDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYY 308

  Fly   321 RSLVDCLKHLPWSKELPSYEDIMDEIRK 348
            ::|...|..|...|.|.:..:...|.::
  Fly   309 KNLQHHLDRLGLDKNLITENNFRKECQR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 80/308 (26%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 79/303 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.