DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG2004

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:425 Identity:90/425 - (21%)
Similarity:156/425 - (36%) Gaps:113/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRG-----GENYCSNIYRAQI-KYRNAE----SCAM 66
            ::.:|...||:..::...    |.:.|:...|     |:.|.|.::|..| ..:.||    ...:
  Fly    10 ISAKFSEATLDEIIRNAG----GTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQL 70

  Fly    67 ETSLIVKSMPD--EKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQ 129
            |.|:|||:|||  .::.:...:..:..|..||..:.|.:||..       .:...|||..: ...
  Fly    71 EISVIVKAMPDNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQ-------KSRQPAPKKPF-VEY 127

  Fly   130 P----------EQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIV 184
            |          ...|.|||:...||:...||..:..:.|.|.|..|..:|.:.            
  Fly   128 PRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDALLTMRTLGRFHGVA------------ 180

  Fly   185 DRYPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYH------------EHF 237
                   |..:|::|:.|:                 :..|.:....|..|            |:.
  Fly   181 -------LAFNALDSKNFE-----------------KAAGSLEETYYGEHTREWYTGFLLLAENV 221

  Fly   238 TERVLKAVYP-------------------------LRGNHNVLNHGDLWVNNIFFKYDAEYTVQQ 277
            ....:|.:||                         .|...:|..|||.|..|...||:.....::
  Fly   222 ATDAVKQIYPNSKYETVATNFLQPPLFDDLINLVSTRSKLSVFGHGDCWTPNFLTKYNERGQSEE 286

  Fly   278 VKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCLKHLPWSKE-LPSYED 341
            :.||||||....||..|:::|:.:....|:......||:..|..|..|.::.|..:.| :.|:|.
  Fly   287 IIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESAQDLIQDLGGNAESIISWES 351

  Fly   342 IMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL 376
            :.:|::....:|..:.....|:..|     ||:.:
  Fly   352 LQEELKNFGRFGCGMGIESLPMTMM-----EDDEV 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 75/345 (22%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 74/341 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
44.060

Return to query results.
Submit another query.