DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG32195

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:425 Identity:111/425 - (26%)
Similarity:201/425 - (47%) Gaps:53/425 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EPPLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMET-SL 70
            |..:| :.::|.|.|........|:|....:..:::.|||:||.|||..:.:|.:...|:|: ..
  Fly     2 EREIY-SAEYFERALARAYGCEMLRVENFHIKAVSQKGENFCSVIYRVALVFRRSPDGALESGKY 65

  Fly    71 IVKSMPDEKQAILARLHIYNKETLFYMHIKPKLEALMWRA----------VDSFSAWTLAPKHYY 125
            |:|.:.....|:..     |::.:|.: :.|.::|::..|          .|.......|.|..|
  Fly    66 ILKDLLPAAAALGT-----NEKDMFEV-LLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELY 124

  Fly   126 STTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETI----VDR 186
                     |||||.|.||:...|:.||:.:.|.:.:.|||::|..:.|:.|::||.|    ...
  Fly   125 ---------ILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSH 180

  Fly   187 YPFGLLHMDAINSEPFKLLFGTQLLKLAALVGDCEGFG----GITTKL-YRYHEHFTERVLKAVY 246
            |..||       ::.|     .|.|.|.......|.|.    .|:.|: .:..:.:|:|:...|.
  Fly   181 YANGL-------NDRF-----AQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVD 233

  Fly   247 PLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDR 311
            |.:.:.|.:.|||.|:|||.|    ::..::..::|||.|::||...|:.:...|||:.|:|.:.
  Fly   234 PNKSSLNAVIHGDPWLNNIMF----DFVNKKATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNN 294

  Fly   312 RQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSL 376
            :.||::.|:.:|::.|:|..:...||::..:.||:::...||::......|:.......|.|..:
  Fly   295 QDELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCELPICCASPEASVDFGV 359

  Fly   377 KNFHDETFARQKVQLMFEGNTRTLESLKCTLKRLD 411
            ..|.|.....:|...:| .:.|..:::|.||...|
  Fly   360 HTFVDTDAMLKKRHQLF-ASERVRQTIKATLLMFD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 85/306 (28%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 86/308 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459191
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.