DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and CG33301

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:433 Identity:117/433 - (27%)
Similarity:183/433 - (42%) Gaps:55/433 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVK 73
            |.:||..:.:..|....|...|||:.:.....|..|||:...:.|..:.|:..:...:..:.|| 
  Fly     3 PTWLTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYIV- 66

  Fly    74 SMPDEKQAILARL---------HIYNKETLFYMHIKPKLEALMWRA-VD-SFSAWTLAPKHYYST 127
                 |||:.|.:         .:|.:|...|..|.|||:.|:..| :| ..:|..:.....|: 
  Fly    67 -----KQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYN- 125

  Fly   128 TQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLL 192
                 |:|||||....:....|...||..|..|.:..||::||.::|:.||.|..:...:   ..
  Fly   126 -----TMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQERHPNLLTKCF---YT 182

  Fly   193 HMDAINSEPFKLLF------------GTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAV 245
            |..:.:.:.:.::|            |...||        |.:|   .||::...|..|...:|.
  Fly   183 HFFSRDKKAYSVVFAGLFKAFLRFIDGQPNLK--------EAYG---DKLHKLRTHIMEYGARAY 236

  Fly   246 YPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRD 310
            .....:...|||||.|..||.|:||.....:.|..||||.....|...|::||..|||..|| .|
  Fly   237 DVGESDLKTLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEV-GD 300

  Fly   311 RRQELVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVD--SED 373
            :..|||:.:|::|...|:...:...||:.::...:..:|. :...:|..|.|.|...|.:  |:.
  Fly   301 KESELVEHHYKALKANLEKFSYKGSLPTLQEYRLQFERRR-FMSLLAHMFKPCMIYNGSEETSDF 364

  Fly   374 NSLKNFHDETFARQKVQLMFEGNTRTLESLKCTL--KRLDELK 414
            :||.....|....||.....|...|:...|...|  |.|.||:
  Fly   365 SSLYAESPEGLRYQKSVYASEAVIRSATKLLAILDAKGLLELQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 86/309 (28%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 86/311 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459185
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
98.860

Return to query results.
Submit another query.