DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and nhr-246

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:351 Identity:73/351 - (20%)
Similarity:123/351 - (35%) Gaps:121/351 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LIVKSMPDEKQAILARLHI----YNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQP 130
            :||..|.::     .:||.    :|::.||             :.||.     |...|.:|.|..
 Worm   134 VIVLEMLED-----CKLHDLIPGFNEDQLF-------------KIVDE-----LVKLHIFSLTTE 175

  Fly   131 EQTIILED---LCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLL 192
            :...|:.|   |..:|: |:|.        .|.|..|||:...|.::::..|             
 Worm   176 KWKEIVPDESKLAMSGF-LQCM--------VADVGRKLAQNPELGVILSYVE------------- 218

  Fly   193 HMDAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNH 257
              :.::::|                              .|.:...:..:....|     :|:.|
 Worm   219 --NTLDTDP------------------------------NYLQKMRDEYINEERP-----SVICH 246

  Fly   258 GDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRS 322
            ||||...|.  :|.|..:  ..|:|:|....||...|:::.|:|...::..:...:.|:|.||..
 Worm   247 GDLWAPQIL--WDKEDNI--AGIVDWQATHRGSPMEDLHHILSTCTSVQNRKTFTKPLLDHYYNK 307

  Fly   323 LVDCLKH----LPWSKELPSYEDIMDEIRKREAYGF-------FVAFGFFPLMSMIGVDS--EDN 374
            |...||.    ..|::|         ||.....|.|       ..|.||:....::..|.  :..
 Worm   308 LKVGLKEKGFKTTWTRE---------EIDIEYNYSFIYGASRTIFANGFWANSPVLQTDGKPDPE 363

  Fly   375 SLKNFHDETFARQKVQLMFEGNTRTL 400
            .:|    |:|.|.|..|  |...|.|
 Worm   364 RIK----ESFVRCKSYL--EDTIREL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 54/270 (20%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 53/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.