DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and T16G1.3

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:376 Identity:76/376 - (20%)
Similarity:152/376 - (40%) Gaps:101/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ILARLHIYNKETLFYMHIKPKLEALMW------------RAVDSF---SAWT-----LAPKHYYS 126
            |.:.:|:.|  .|..|:::.|.|:.:|            |.|:.:   ..|.     ::||.::|
 Worm    48 ITSCMHVLN--VLDQMNLQDKSESALWSIFEYEAQGLHNREVNLYEIIGKWNMDDVLMSPKVFFS 110

  Fly   127 TTQPEQTIILEDLCAAGYQLK------CRQLGLDFDHAAL--VMAKLAEYHALTMVMAEREPETI 183
                 :....|:|....:.::      .|.|.::.....|  ::..||.:.|.::.:.:||.|::
 Worm   111 -----KKFDSENLTKGFFAMEYVDNAITRHLYINLKSYELHSILKSLAVFQAESLKLNKREQESV 170

  Fly   184 ----VDRYPFGLLHMDAINS--EPFK--------------LLFGTQLLKLAALVGDCEGFGGITT 228
                :::....:...:.:||  |..:              .:||.:|:.. .||.:...:.||  
 Worm   171 TGYDLEKIVGKMFSQNGLNSIFEQVRQINKEELSEAADKIAVFGVELVNF-DLVKNLNNYLGI-- 232

  Fly   229 KLYRYHEHFTERVLKAVYPLRGNHNVLNHGDLWVNNIFFKYDA-EYTVQQVKIIDFQLCFYGSLG 292
                                  ..|||.|||||..||.:|.:. |:.|.  ||||:|....|:..
 Worm   233 ----------------------KKNVLVHGDLWSANIMWKENKDEFRVD--KIIDYQSIHLGNPA 273

  Fly   293 FD-INYFLNTSLELEVLRDRR-QELVDIYYRSLVDCL--KHLPWSKELPSYEDIMDEIRKREAYG 353
            .| :..|::|....|  |.:. ::|::.:|...::.|  |::|::.|           :.:|:|.
 Worm   274 EDLVRLFISTLSGSE--RQKYWEKLLEQFYEYFIEALEDKNVPYTLE-----------QLKESYR 325

  Fly   354 FFVAFGFFPLMSMIGVDSEDNSLKNFHDETFARQKVQLMFEGNTRTLESLK 404
            .:...|...::.|.|..:| ..|....|....::..:::.|...|.|..::
 Worm   326 LYFVTGSLLMLPMFGPIAE-VKLAEMSDPDEVKKYREILTEKTKRLLNDME 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 63/300 (21%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 76/376 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.