DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and H37A05.2

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:301 Identity:69/301 - (22%)
Similarity:117/301 - (38%) Gaps:74/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VKSMPDEKQAILARLHIYNKETLFY---MHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQT 133
            :|||    .:::..||  |:|...|   |..||....:...::::|:  .|:|...|        
 Worm   103 MKSM----TSLVKELH--NREVDMYRIIMREKPACPTVNVLSLEAFT--ELSPLKAY-------- 151

  Fly   134 IILEDLCAAGYQLKCRQLGLD----FDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHM 194
            ||.|      |......:|::    .:....|:..:|.:.|:...|:|.|.:    :...|.:::
 Worm   152 IISE------YIPNLHHVGMNDCISIEEIWAVVDGIAAFSAMGESMSEDEKK----KSTIGEIYI 206

  Fly   195 DAINSEPFKLLFGTQ-----LLKLAALVGDCEGFGGITTKLYRYHEHFTERV------------- 241
            :    |..|..|..|     ...|..::|            ..|.|...|.:             
 Worm   207 E----EAVKYFFDDQSPDNMRKNLIMILG------------VAYEEKVEEAMDIFDLYCGSSEIQ 255

  Fly   242 --LKAVYPLRGNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLE 304
              ...|....|:..||.|.|:|.:|:.|...:|..::...:||||.....|.|.|:.....|.|.
 Worm   256 KNYSRVSAFLGHSPVLMHSDIWPSNLLFSLSSENKLEFKALIDFQTASLSSPGLDVGCLTVTCLS 320

  Fly   305 LEVLRDRRQELVDIYYRSLVDCLK---HLPWSKEL--PSYE 340
            .:..|..:.|::|.||:|.|..||   .:|:::|.  .|||
 Worm   321 KKDRRTVQSEILDRYYKSFVKSLKTPNSIPYTREQLEDSYE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 64/287 (22%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 69/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19004
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.