DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and H06H21.8

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:414 Identity:94/414 - (22%)
Similarity:169/414 - (40%) Gaps:57/414 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RRTLEHGLQQLD--LQVIGVQLTNLTRGGENYCSNIYRAQIKYRNAESCAMETSLIVKSMPDEKQ 80
            ||.:|....:::  .:.:......| ...:::.|.||.|.:|. ..:...:..|:.:| :|...:
 Worm     9 RRLVESSFPEIENFHEKVDASFEKL-ENAKSFWSEIYVAHLKV-VGDGVKVPESVFIK-VPRISE 70

  Fly    81 AIL-------------ARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYS-TTQPE 131
            .:|             ..|:...||.|||.|.:       :.::.:|.    .||.|:: ....|
 Worm    71 NVLRCEDESAVNHLNDVLLYYSKKENLFYKHFE-------YGSIPNFP----FPKVYFTEDINGE 124

  Fly   132 QT--IILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDRYPFGLLHM 194
            .|  |:.|:|....:.:: ...||..:....:|..||..|:..|   :|:.::.|:.:..| .|.
 Worm   125 ATGGIVAENLSEKVFAVE-HIPGLKHEQILRLMEALAGLHSFLM---KRDDKSYVESFVEG-AHG 184

  Fly   195 DAINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGD 259
            ....||..:.:...:.|.|..:  ..|.||....:..::...::.:.......:.....::.|.|
 Worm   185 RETFSEGMQNMMFEEALTLENV--SPEVFGNDRIRNIKWSFDYSIKNKATADAISAFPGIICHAD 247

  Fly   260 LWVNNIFFKYDAEYTVQQVK-IIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSL 323
            |.|.|:.:|.|:  ...::. |||:|:.|.||:.|||...|...|..|:.|...|..:|.|:::|
 Worm   248 LNVTNVLWKKDS--AKDEISAIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLDHYHKTL 310

  Fly   324 VDCLK-HLPWSKE--LPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFHD-ETF 384
            .:... ..|:|.|  |..|..|         |.|...|..|.:...|.:.| |.:|.|..| |..
 Worm   311 TELSNGKAPFSMEELLHQYSLI---------YPFSSNFSLFGIALYIKMYS-DGTLGNPEDKEEN 365

  Fly   385 ARQKVQLMFEGNTRTLESLKCTLK 408
            .::.:.... |....:|:||...|
 Worm   366 CKELIDRAL-GIVEDIEALKNNYK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 68/304 (22%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 46/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17073
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.