DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and E02C12.9

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:219 Identity:49/219 - (22%)
Similarity:95/219 - (43%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TQLLKLAALVGDCEGFGGITTKLYRYH-----EHFT--ERVLK---AVYPLRGNHNVLNHGDLWV 262
            :||...::|....:|...:..|...|.     |.|.  :::||   .:..|.|..:||||||||.
 Worm   149 SQLFNSSSLQKHFQGMYSVFEKEKYYQVDGLIETFVVYQKLLKKYTKISELLGFKSVLNHGDLWQ 213

  Fly   263 NNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVDCL 327
            :|:....:....::...|||:|.......|.|....:...|..|..|::..:|:.:|:::.::. 
 Worm   214 SNMIHSMENNGKLKLEAIIDWQSTVILPPGLDTAELIVGCLSAEDRREKGHDLLLLYHKTFINV- 277

  Fly   328 KHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDNSLKNFH----DETFARQK 388
                :..|:.|:|::.|      :|..     :||:.:::.|....:.:.|..    :...:..|
 Worm   278 ----FGSEVFSFEELQD------SYNL-----YFPMAAILIVPGMISFMTNTQITEAERIHSMSK 327

  Fly   389 VQLMFEGNTRTLESLKCTLKRLDE 412
            :..:.|.   ||:..|..|||..:
 Worm   328 ITAIVED---TLKIHKQNLKRFPD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 32/131 (24%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 46/212 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.