DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and C29F7.1

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:153 Identity:38/153 - (24%)
Similarity:68/153 - (44%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 NVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVD 317
            :||.|||||...|.:..|...    ..|||:|:...||...|::..|:|...:|......:.|:|
 Worm   250 SVLTHGDLWSPQILWDKDDNI----AGIIDWQVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLD 310

  Fly   318 IYYRSLVDCLKH----LPWSKELPSYEDIMDEIRKREAYGFFVAF---GFFPLMSMIGVDSEDNS 375
            .|:..|...|:.    :||::     |::.:|.....:||..:..   |.:....::..|.:.:.
 Worm   311 HYFEKLSAGLEEKGVKMPWTR-----EEVDEEYNHCFSYGASITIFSNGIWSSSPILQTDGKPDP 370

  Fly   376 LKNFHDETFAR------QKVQLM 392
            .:  ..|:|||      :.||::
 Worm   371 AR--ISESFARCQSYVEEAVQVL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 24/80 (30%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4089
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.