DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and C18B10.6

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_504924.1 Gene:C18B10.6 / 182773 WormBaseID:WBGene00015963 Length:436 Species:Caenorhabditis elegans


Alignment Length:350 Identity:78/350 - (22%)
Similarity:132/350 - (37%) Gaps:62/350 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DEKQAILARL--HIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILEDL 139
            |||...||::  ..:|:|...|    ..||......:.....:.|.|  :|.....:..||||.:
 Worm   118 DEKLKYLAKILRDAHNREIETY----KLLEKFNHANIPYTKIYGLKP--FYDENDLKGYIILEYI 176

  Fly   140 CAAGYQLKCRQLGLDFDHAALVMAKLAEYHAL---------TMVMAEREPETIVDRYPFGLLHMD 195
              ...........:..|.....:..:|.:.||         |..:.....|...|.: .|...::
 Worm   177 --PNIHTTSMSENIPADDLISTIRAVATFGALGACLPADQKTFALGANFLEYYYDTF-LGAAGVE 238

  Fly   196 AINSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGDL 260
            :|.....|.|...:..|:..|:           .:||::.....:..| :..:.|.|.|.|||||
 Worm   239 SILDNLRKSLSFCETSKVEKLI-----------DIYRHYIKIVSKFSK-IDEILGFHLVPNHGDL 291

  Fly   261 WVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVD 325
            |.:|:.|..:....::...:||:|.......|||:......:|.:|..|.|..|.:.||:.:...
 Worm   292 WQSNMLFNTEESGHLKLKALIDWQAVANLPPGFDMVRLFIGALSIEDRRQRASEFLKIYHETFTT 356

  Fly   326 CLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMI---GV----DSEDNS---LKNFH 380
            .     :..||..|::|.|..:..           |||.|::   |:    ||..:|   .|...
 Worm   357 V-----FGSELFPYQEIHDSYKLH-----------FPLKSLMVLPGIATFLDSSQHSESEKKTVR 405

  Fly   381 DETFARQKVQLM---FEGNTRTLES 402
            :||..: .:.||   ||.:...|::
 Worm   406 NETMTK-IIALMEDVFEAHEYNLKN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 57/263 (22%)
C18B10.6NP_504924.1 DUF1679 21..427 CDD:369592 77/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.