DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and F58B4.5

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:286 Identity:54/286 - (18%)
Similarity:95/286 - (33%) Gaps:114/286 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VMAKLAEYHALTMVMAEREPETIVDRYPFGLLHMDAINSEPFKLLFG-----------TQLLKLA 214
            |:..:|.:.|:.|.::|.|     .:|..|...:|        ::||           ..|||.:
 Worm   179 VIHAIAAFSAIGMKLSEEE-----TKYARGADFLD--------IVFGQFMDEKSIERMNVLLKAS 230

  Fly   215 ALVGDCEGFGGITTKLYRYHEHFTERV-------------------LKAVYPLRGNHNVLNHGDL 260
                              :.|.:.|:|                   .|......|...||.|.||
 Worm   231 ------------------FPEEYLEKVEEMLKIYKDYYFQPQMIKNFKNTCQFFGYKPVLTHSDL 277

  Fly   261 WVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLVD 325
            |.:|.....|.| .|....|||||.....:...|:.....:.|..:..|::...|::.||.:.|:
 Worm   278 WSSNFLCTRDGE-KVTLKAIIDFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVN 341

  Fly   326 CLKHLPWSKELP-SYEDIMDEIRKREAYGFFVAFGFFPLMS------------------------ 365
            .|..:    ::| :::.:.|..:.           :||||:                        
 Worm   342 ELDGM----DVPYTFQQLKDSYQV-----------YFPLMTTMVLPGIAPMLQHSNVTEEYKDSM 391

  Fly   366 -------MIG-----VDSEDNSLKNF 379
                   |||     :.:.::::|||
 Worm   392 KQVALDKMIGLLEDVITTHESNIKNF 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 42/198 (21%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 51/281 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.