DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7135 and D1044.1

DIOPT Version :9

Sequence 1:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:352 Identity:84/352 - (23%)
Similarity:125/352 - (35%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DEKQAILARLHIYNKETLFYMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTTQPEQTIILEDLCA 141
            ||...||..|..  :|..||...          :...||.:.: |:.||......:.  :..|..
 Worm    83 DENMEILRTLTA--QEVTFYSDF----------SGIQFSGFPI-PRSYYGENLGNEK--MAGLAC 132

  Fly   142 AGYQLKCRQL----GLDFDHAALVMAKLAEYHALTMVMAEREP-----ETIVDRYPFGLLHMDAI 197
            ..|..|...:    |.|......::..||.:||..:.:::..|     ..:.|.....:||.|.:
 Worm   133 EDYSGKVYSIDFVPGFDESQVLQLLEALAHFHAKIIEISDEIPWKNYENVLYDAAYIRMLHNDTL 197

  Fly   198 NSE---PFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLRGNHNVLNHGD 259
            :.|   |.:|....|.:|.|.   |.:|        .|..|...|   |...||...||.||..:
 Worm   198 DFEKLCPAELSGRIQEVKHAF---DEDG--------VRNSEKKNE---KLGMPLVICHNDLNASN 248

  Fly   260 LWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQELVDIYYRSLV 324
            :..||...|..|        .||||....|.:.|||...|...|.:|..|...|..::.||.:..
 Worm   249 VLWNNETGKIQA--------FIDFQHVSKGPVSFDIIRILCLGLSVENRRANTQRYLNHYYTTFK 305

  Fly   325 DCLKHLP--WSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSEDN-SLKNFHDETFAR 386
            ......|  :|:...||         |..:.|..|...|.|.....:..::: .||:..||  ..
 Worm   306 SHFSTAPFTFSQLEESY---------RTHFNFVNATSLFSLSYYYKMYKDESLDLKSGADE--RE 359

  Fly   387 QKVQLMFEGNTRTLESLKCTLKRLDEL 413
            .|.|          |.|:.|:..||::
 Worm   360 HKAQ----------EILRRTIGILDDM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 64/264 (24%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 51/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.