DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and AT5G15570

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_197061.1 Gene:AT5G15570 / 831410 AraportID:AT5G15570 Length:381 Species:Arabidopsis thaliana


Alignment Length:294 Identity:57/294 - (19%)
Similarity:93/294 - (31%) Gaps:122/294 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALINMGIS------------------ 85
            :|||||.::...|..||.:|..|..::||......|:..||.::|..                  
plant    67 ALETLTDVVIQYIQNIGKTAQFYVNMAGRVESNALDIVQALEDLGSGLGFDGAHDVEHCLADSGV 131

  Fly    86 ISNLDPYMRKETHVP----IPLPPQQTQQRPL-SLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTP 145
            :.::..|..:...:|    :|..|....:||. |....|::.|..| :|.:.|..|:        
plant   132 VKDIIRYTGEAEEIPFVYSLPRFPFNRGKRPAPSFSDIGVEPPDEH-IPVWLPAFPE-------- 187

  Fly   146 THKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKPAFPPYAAALN 210
                                       ||....:.|.|                           
plant   188 ---------------------------TKMSNGSEEIN--------------------------- 198

  Fly   211 PTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSENEEMDGDKSKEEK--PELDI-KPNSNTNK 272
             .|::               ..|..|:|:|....|..:.:|.|:.|.:|  .:.|: ||      
plant   199 -VDKI---------------ERDVQSRDNGSSLMSVQQSVDVDRLKVQKSMDQKDVQKP------ 241

  Fly   273 AILENPNIDNPYLRAATLPKRSKN-------CPT 299
              :|.|. .||:| ||.:....||       ||:
plant   242 --IEEPE-GNPFL-AAPIWVGEKNVSLSRVVCPS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 16/66 (24%)
TAF8 126..179 CDD:176263 6/52 (12%)
AT5G15570NP_197061.1 BTP 25..116 CDD:128846 16/48 (33%)
TAF8 176..221 CDD:299470 14/123 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2568
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.