DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and TAF8

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_567964.1 Gene:TAF8 / 829584 AraportID:AT4G34340 Length:353 Species:Arabidopsis thaliana


Alignment Length:199 Identity:47/199 - (23%)
Similarity:86/199 - (43%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLAL-------- 79
            |:|:....|.....:.:||:|:......|.::|.:|.::..|:||:...|.|:.|||        
plant    35 VAQVCESVGYENFKDPALESLSGFALQYILQLGKTATSFANLTGRSQCNVFDIILALDDLTDNNG 99

  Fly    80 ----------INMGISISNLDPYMRKETHVPI--PLP--PQQTQQRPLSLLQAGI---KAPHPHY 127
                      :...|.:..:..::.....||.  |||  |.....|...::.:.:   :.|...:
plant   100 E
QGISSESCSLGRSIKLREIIDFVNSSEEVPFSQPLPSFPVAISDRSRKMIPSFVEIGETPPGKH 164

  Fly   128 VPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKAL----TKFLCKTTETNNLFPT 188
            :|.:.|..||||.|..||...:.|::....:.:.|.|:|..|:||    .|.:||.:..|.::..
plant   165 IPLWLPAFPDPHTYKETPMWIERVSDPRGDKIEQARQRRKAERALLSLQRKLVCKISSRNPVWGD 229

  Fly   189 EDNM 192
            .|.:
plant   230 MDGV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 18/82 (22%)
TAF8 126..179 CDD:176263 18/56 (32%)
TAF8NP_567964.1 Bromo_TP 24..100 CDD:284856 17/64 (27%)
TAF8 164..216 CDD:176263 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2568
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 1 1.000 - - oto3972
orthoMCL 1 0.900 - - OOG6_104008
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.