DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and AT3G02160

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001325701.1 Gene:AT3G02160 / 821295 AraportID:AT3G02160 Length:397 Species:Arabidopsis thaliana


Alignment Length:352 Identity:71/352 - (20%)
Similarity:125/352 - (35%) Gaps:114/352 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKVEAVTVSNVDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSG 66
            |.||      |:||:.      ||.............:|:|||.:....|..||.:||.|..|:|
plant    57 ESVE------VNPYQE------SQTREGVRFSSFQESALDTLTDVAVQYIQSIGKTAHLYANLAG 109

  Fly    67 RTMPTVGDVSLALINMG-----ISISNLD-------------PYMRKETHVP----IPLPPQQTQ 109
            |......|:..||.::|     ..:|:.|             .|..:...:|    :|..|...:
plant   110 RVDGNSLDILQALEDLGSGLGFAGVSDTDHCLADSGVVKDIIRYTGEAEEIPFVYSLPRFPFSKE 174

  Fly   110 QRPL-SLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQ--------- 164
            ::|. |..:.|.:.|..| :|.:.|..|:.....|:........|.|...::....         
plant   175 KKPAPSFSEVGAEPPDEH-IPVWLPAFPETELCDRSEETNAATIEGEIPSKENGSSLPSMQLSFD 238

  Fly   165 ---KRDIEKALTKFLCKTTET---NNLFPT------EDNMFPLIACKPA-----------FP--- 203
               :.:|.|: :|.:.::||.   .|||.|      |.|:.|::  :|.           .|   
plant   239 GGGRLEIHKS-SKDVGESTEAVVEGNLFLTAPLRFVEKNVSPVV--RPLELSNEVVRTNHVPDKH 300

  Fly   204 -------PYAAALNPTDQV---------FDFEELEYHYLVANR------------------TEDE 234
                   |...|..|:|::         .|.|:::    ||.:                  .::.
plant   301 VRNNHHIPILEASAPSDKINNKNWLAISKDVEKVD----VARKELTLVRFKIGTTKRSMCLAKNR 361

  Fly   235 PSKDDG--EEGDSENEEMDGDKSKEEK 259
            ..:::|  :||:.:.|:....|.|.|:
plant   362 SFQEEGWFQEGEDKREKTSEIKEKRER 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 20/77 (26%)
TAF8 126..179 CDD:176263 10/64 (16%)
AT3G02160NP_001325701.1 BTP 41..131 CDD:128846 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.