DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and Taf8

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_036016625.1 Gene:Taf8 / 63856 MGIID:1926879 Length:322 Species:Mus musculus


Alignment Length:235 Identity:102/235 - (43%)
Similarity:144/235 - (61%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALI 80
            ||.|..|||.||.:.|...|...|:||||:|||:.|.|||.||.:|||.:.||.||:.|:.:.|:
Mouse    32 RRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLV 96

  Fly    81 NMGISISNLDPYMRKETHVPIPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTP 145
            .||.::..|..|.::...:.|..||...|......|.||...|||.::||:||..||||.||:||
Mouse    97 EMGFNVDT
LPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTP 161

  Fly   146 THKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKPAFPPYAAALN 210
            |:::||::|:.:|||||.|:||:|:|||:|:.||.||.:||..:.:.|||||.:|...||..||.
Mouse   162 TYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALL 226

  Fly   211 PTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSENEEM 250
            |:       |||...:     |:..|.:..|:.|:||..:
Mouse   227 PS-------ELEIQQM-----EETDSSEQEEQTDTENNAL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 35/71 (49%)
TAF8 126..179 CDD:176263 29/52 (56%)
Taf8XP_036016625.1 Bromo_TP 27..104 CDD:400073 35/71 (49%)
TAF8 142..195 CDD:176263 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830648
Domainoid 1 1.000 77 1.000 Domainoid score I8887
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11094
Inparanoid 1 1.050 210 1.000 Inparanoid score I3653
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48468
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 1 1.000 - - oto94721
orthoMCL 1 0.900 - - OOG6_104008
Panther 1 1.100 - - LDO PTHR46469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.