DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and taf8

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_012818203.1 Gene:taf8 / 549471 XenbaseID:XB-GENE-491356 Length:293 Species:Xenopus tropicalis


Alignment Length:291 Identity:115/291 - (39%)
Similarity:164/291 - (56%) Gaps:20/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TVSNVDPY----RRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRT 68
            |.:..|.|    ||.|..|||.||.:.|...|...::|:||:|||:.:.|||.||.:|||.:.||
 Frog    12 TSTPADNYMLARRRTLQVVVSSLLTEAGFESAEKAAVESLTEMLQSYLSEIGRSAKSYCEHTART 76

  Fly    69 MPTVGDVSLALINMGISISNLDPYMRKETHVPIPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFP 133
            .||:.|:.:.||.||.::.:|..|.::...:.|..||..........|.||....||.::||:||
 Frog    77 QPTLPDIVVTLIEMGFNVESLPAYAKRSQRMVITAPPVTNNPVVPKALSAGQNKQHPAHIPSHFP 141

  Fly   134 PMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIAC 198
            ..||||.||:|||:::||.:|:.:|||||.|:||:|:|||:|:.||.||.:||..:.:.|||||.
 Frog   142 EFPDPHTYIKTPTYREPVCDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDTSTFPLIAA 206

  Fly   199 KPAFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSENEEM--DGDKSKEEKPE 261
            :|...||..||.|:       |||     ..:.|:..|.:..::.|:||..|  .||:...||..
 Frog   207 RPLSIPYLNALLPS-------ELE-----LQQVEETDSSEQDDQTDAENLSMHLQGDEVGMEKEN 259

  Fly   262 LDIKPNSNTNKAILENPNIDNPYLRAATLPK 292
            ..:...::....  |...|||||||....||
 Frog   260 SSVLQQNSMKGG--EETLIDNPYLRPVKKPK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 34/76 (45%)
TAF8 126..179 CDD:176263 29/52 (56%)
taf8XP_012818203.1 Bromo_TP 22..96 CDD:369402 33/73 (45%)
TAF8 134..187 CDD:176263 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8718
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11094
Inparanoid 1 1.050 203 1.000 Inparanoid score I3640
OMA 1 1.010 - - QHG48468
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 1 1.000 - - otm49180
Panther 1 1.100 - - LDO PTHR46469
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.