DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and taf3

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001036209.1 Gene:taf3 / 334474 ZFINID:ZDB-GENE-030131-6406 Length:898 Species:Danio rerio


Alignment Length:340 Identity:84/340 - (24%)
Similarity:130/340 - (38%) Gaps:81/340 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALI 80
            |.:|...|:|:....|.......:.:.|:.:|:..:.::..|.|.|.||.|||.|.:.||..|..
Zfish     7 RSLLRVSVAQMCQAVGWDAVQLSACDLLSDVLERYVQQLAKSCHRYSELYGRTDPGLSDVDQAFG 71

  Fly    81 NMGISISNLDPYMRKETHVPIPLPPQQTQQRPL---SLLQ---AG--------IKAPHPHYVPSY 131
            .:|:||:.|:.|:....  ||.. ||...|.|:   |:||   ||        ::.....|:|.|
Zfish    72 FLGVSIAE
LEDYVNNVE--PIGY-PQTIPQFPISKSSVLQFPAAGFDTDARDALRGERRDYIPEY 133

  Fly   132 FPPMPDPHAYIRTPTHKQPV-----TEYEAIR-----EKAACQKRDIEKALTKFLCKTTETNNLF 186
            |||:.   :.......::||     |..||::     |:...::.:.|..|::...::.....|.
Zfish   134 FPPLV---SLQEDEEEEEPVPADMGTSAEAMQVSMGEEEDGEEEENDENWLSRHDGQSPRPEGLL 195

  Fly   187 PTEDNMFPLIACKPAFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSEN-EEM 250
            |....  |.::.||...|                 |:.|        ||.    |...|.| :.|
Zfish   196 PAAKR--PRLSTKPGVSP-----------------EWSY--------EPR----EPLSSLNSQHM 229

  Fly   251 DGDKSKEEKPEL---DIKPNSNTNKAILENPNIDNPYLRAATLPKRSKNCPTPGTMPSRSLATTA 312
            ....|....|||   .:.|.:..:|..|.:|:           |.|.||     ..|.|..|...
Zfish   230 PHSPSPPLSPELPRPPVAPPTPGHKPKLPSPS-----------PARQKN-----KSPKRGGAAPT 278

  Fly   313 PTIRTPSTLEITKTN 327
            ..:..|.||...|||
Zfish   279 GVLGRPLTLTPPKTN 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 22/71 (31%)
TAF8 126..179 CDD:176263 14/62 (23%)
taf3NP_001036209.1 BTP 5..79 CDD:128846 22/71 (31%)
PHD_TAF3 836..881 CDD:276997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.