DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and Taf8

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_008765082.1 Gene:Taf8 / 316216 RGDID:1308423 Length:334 Species:Rattus norvegicus


Alignment Length:232 Identity:102/232 - (43%)
Similarity:143/232 - (61%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALI 80
            ||.|..|||.||.:.|...|...|:||||:|||:.|.|||.||.:|||.:.||.||:.|:.:.|:
  Rat    32 RRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLV 96

  Fly    81 NMGISISNLDPYMRKETHVPIPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTP 145
            .||.::..|..|.::...:.|..||...|......|.||...|||.::||:||..||||.||:||
  Rat    97 EMGFNVDT
LPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTP 161

  Fly   146 THKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKPAFPPYAAALN 210
            |:::||::|:.:|||||.|:||:|:|||:|:.||.||.:||..:.:.|||||.:|...||..||.
  Rat   162 TYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALL 226

  Fly   211 PTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSEN 247
            |:       |||...:     |:..|.:..|:.|:||
  Rat   227 PS-------ELEIQQM-----EETDSSEQDEQTDTEN 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 35/71 (49%)
TAF8 126..179 CDD:176263 29/52 (56%)
Taf8XP_008765082.1 Bromo_TP 27..104 CDD:284856 35/71 (49%)
TAF8 142..195 CDD:176263 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334366
Domainoid 1 1.000 78 1.000 Domainoid score I8583
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11094
Inparanoid 1 1.050 212 1.000 Inparanoid score I3569
OMA 1 1.010 - - QHG48468
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 1 1.000 - - oto98226
orthoMCL 1 0.900 - - OOG6_104008
Panther 1 1.100 - - LDO PTHR46469
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2702
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.