DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and taf8

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_588062.1 Gene:taf8 / 2539131 PomBaseID:SPCC1259.06 Length:222 Species:Schizosaccharomyces pombe


Alignment Length:182 Identity:49/182 - (26%)
Similarity:75/182 - (41%) Gaps:30/182 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALINM 82
            ::..::.||..|.....|....:|.:.:.|:....|:  :.|.  :||..|:||..||:|.|..:
pombe     4 VIANILQQLGFDSMTKAAEASFVEAVDKYLRNSFREL--ALHT--QLSKHTIPTTKDVALWLNLL 64

  Fly    83 GISISNLDPYMRKETHVPIPLPP----------QQTQQRPLS-------------LLQAGIKAPH 124
            .|.:|:|...:.|...   ||||          .::|..|..             |....:....
pombe    65 NIPMSSLQTELEKYLK---PLPPAINDELDRLANESQDIPSKFKSSLDSKMVSQLLGSLAVSQNR 126

  Fly   125 PHYVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKALTKFL 176
            |.||.::.||.|..|.|:.||.:....|..:.|||.|..:.|..|.||.|.|
pombe   127 PAYVVNHLPPFPASHTYMATPVYPVRPTSPKQIRELATQESRLAEHALRKIL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 18/69 (26%)
TAF8 126..179 CDD:176263 20/51 (39%)
taf8NP_588062.1 TAF8_C 129..177 CDD:287390 18/47 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.