DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf8 and taf-3

DIOPT Version :9

Sequence 1:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001257272.1 Gene:taf-3 / 181704 WormBaseID:WBGene00006384 Length:1007 Species:Caenorhabditis elegans


Alignment Length:417 Identity:86/417 - (20%)
Similarity:144/417 - (34%) Gaps:121/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKVEAVTVSNVDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELS 65
            ||:.::::..:...|:  |......:|.|.|....:..:...|..:|::.|.|..:|...:.||:
 Worm     1 MEESQSLSAHDFAVYK--LQDTCKSILRDFGFTSVAQSANSKLAALLRSKINEYAHSTRAFMELA 63

  Fly    66 GRTMPTVGDVSLALINMGISISNLDPYMRKETH-----VP-IPLPPQQTQQRPLSLLQAGIKAPH 124
            |||.|...||..|..:..:|:.:|..|.::...     :| ||:|.|:..:...:..:: :..|.
 Worm    64 GRTKPVTNDVIAAFKHQKVSLPDLKDYAKQVKSEMLHALPVIPVPDQEIAKSDDNFFRS-MYGPK 127

  Fly   125 P---------HYVPSYFPPM-------------PDP------------------------HAYIR 143
            |         .::||:|..:             ||.                        :.|.|
 Worm   128 PSEKELEERREHIPSHFRALHPEWIEEENKEKPPDDTGTRKVVKSAEEREQDEFNKLKRINTYRR 192

  Fly   144 --TPTHKQPVTEYE--AIREKAACQKRDIEK-----------ALTKF---------LCKTTETNN 184
              .|..:|...|.|  ...|.|..:||:.|:           .|..|         ..|..|.|.
 Worm   193 NENPEVQQAREEKERREAEEAAYAKKRNHERFKKGITALPGSTLPNFEDMNFVETGFFKDFEENK 257

  Fly   185 LFPTEDNMFPLIACK--PAFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSEN 247
            ....|..:....|.|  |..||  ..:|.....|..:.:......:......||..:..|...:|
 Worm   258 RLEAERRLQVQNASKVAPTLPP--PVVNKPLPSFSTDSVSASSSASASIMASPSLGEMAEAFLKN 320

  Fly   248 E-EMD-----GDKSKEEKPELD-----------IKPNSNTNKAILENPNIDNPYLRAATLPKRSK 295
            : .||     |...:.:.|..|           :|||              .|||:   ||....
 Worm   321 KIFMDTINAYGKSFEHKSPFKDDSGPAFRLSELVKPN--------------KPYLK---LPGTGS 368

  Fly   296 NCPTPGTMPSRSLATTAPTIRTPSTLE 322
            |   ||:.|| |...::.:|.||:.::
 Worm   369 N---PGSAPS-SRPGSSMSIGTPTKVK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf8NP_523397.1 BTP 15..88 CDD:128846 20/72 (28%)
TAF8 126..179 CDD:176263 18/113 (16%)
taf-3NP_001257272.1 BTP 11..86 CDD:128846 20/76 (26%)
PHD_TAF3 931..976 CDD:276997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1475
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.