DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP16F and ARHGAP12

DIOPT Version :9

Sequence 1:NP_001285400.1 Gene:RhoGAP16F / 32790 FlyBaseID:FBgn0030893 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_060757.4 Gene:ARHGAP12 / 94134 HGNCID:16348 Length:846 Species:Homo sapiens


Alignment Length:493 Identity:120/493 - (24%)
Similarity:197/493 - (39%) Gaps:155/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CFRDRSTTSSSSSQAQHAYVRGHSVTSSTLFRLEGSGGSNCT-LDKAGKQDTGRPEAVVLLRELK 105
            ||.:..::.||..         |..|:|:....|..|..|.| :.:.||               |
Human   441 CFPENESSPSSPK---------HQDTASSPKDQEKYGLLNVTKIAENGK---------------K 481

  Fly   106 TRPNKL---ALLKSSSSKDLTRLFL-DDSTNTAVLVSNTS------------IDVCSSNSSSGGS 154
            .|.|.|   |:|:.||     .||. ...::|:...||.|            |::.|.:.||   
Human   482 VRKNWLSSWAVLQGSS-----LLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSS--- 538

  Fly   155 PAVGRSKSGRDRRNGLECCSSCSKRWHDLKQRMHTLEQDLLVQ----------------TTYSQE 203
                                  .|...:||.|..|   :||:|                |..:|.
Human   539 ----------------------KKNVFELKTRQGT---ELLIQSDNDTVINDWFKVLSSTINNQA 578

  Fly   204 LEQKVGEMSRQLTEL--LQERDRE---RDKDKAR-FAAAGGVAAPGKRTAHGSPNVRPSRLVAWM 262
            :|...| :..::.:.  :::.|:|   :|..|.| |..:...::..|:|.              .
Human   579 VETDEG-IEEEIPDSPGIEKHDKEKEQKDPKKLRSFKVSSIDSSEQKKTK--------------K 628

  Fly   263 NLSNWFKSRPSVETLREQRIFFDEPCFDTELEMVLKHDQHRTVPRIVVDCCDLIEQKYRRSTQPI 327
            ||..:...||:::.:||:....|: .|.:.|..:.:. ::.|||:.|..|.:.:|:    ....|
Human   629 NLKKFLTRRPTLQAVREKGYIKDQ-VFGSNLANLCQR-ENGTVPKFVKLCIEHVEE----HGLDI 687

  Fly   328 EGIYRQCGDYNKIQTLRFSIDANDYDSLRQPD-VDIHTLTGVLKLFLREIKSPLVRVNEAKTFIG 391
            :||||..|:...||.|||:::.::...|.... .|||.:||.||:|.||:..||...|....|:.
Human   688 DGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVN 752

  Fly   392 ----QPNQWLLTDLSAKLDSLKRLIRSLPESNRDTMDYIFGHFNRI------TKVPLQQIS---- 442
                :|.|        ::.::|.|||.||:.|:|||..:|.|..|:      .::..|.|:    
Human   753 AIKQEPRQ--------RVAAVKDLIRQLPKPNQDTMQILFRHLRRVIENGEKNRMTYQSIAIVFG 809

  Fly   443 -------AETLSISVTPSIFHTVPQGVHMQDIQQLLRE 473
                   .||.:|:|     |||.|.   |.::.:|.|
Human   810 PTLLKPEKETGNIAV-----HTVYQN---QIVELILLE 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP16FNP_001285400.1 RhoGAP 306..487 CDD:238090 58/190 (31%)
ARHGAP12NP_060757.4 SH3-WW_linker 71..266 CDD:293224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..241
WW 268..298 CDD:238122
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..466 7/33 (21%)
PH_ARHGAP9-like 465..576 CDD:270053 33/158 (21%)
PH 479..574 CDD:278594 28/142 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..629 10/63 (16%)
RhoGAP_ARHGAP27_15_12_9 654..839 CDD:239868 61/205 (30%)
SH3_ARHGAP12 15..74 CDD:213003
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1079
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.